Skip to content

Commit

Permalink
Update test data
Browse files Browse the repository at this point in the history
  • Loading branch information
susannasiebert committed Apr 17, 2023
1 parent 0b5f0c8 commit 520bc33
Showing 1 changed file with 70 additions and 42 deletions.
112 changes: 70 additions & 42 deletions api_status_tests/blast_response.xml
Original file line number Diff line number Diff line change
Expand Up @@ -2,27 +2,27 @@
<!DOCTYPE BlastOutput PUBLIC "-//NCBI//NCBI BlastOutput/EN" "http://www.ncbi.nlm.nih.gov/dtd/NCBI_BlastOutput.dtd">
<BlastOutput>
<BlastOutput_program>blastp</BlastOutput_program>
<BlastOutput_version>BLASTP 2.11.0+</BlastOutput_version>
<BlastOutput_version>BLASTP 2.14.0+</BlastOutput_version>
<BlastOutput_reference>Stephen F. Altschul, Thomas L. Madden, Alejandro A. Sch&amp;auml;ffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), &quot;Gapped BLAST and PSI-BLAST: a new generation of protein database search programs&quot;, Nucleic Acids Res. 25:3389-3402.</BlastOutput_reference>
<BlastOutput_db>refseq_protein</BlastOutput_db>
<BlastOutput_query-ID>Query_36113</BlastOutput_query-ID>
<BlastOutput_db>refseq_select_prot</BlastOutput_db>
<BlastOutput_query-ID>Query_20989</BlastOutput_query-ID>
<BlastOutput_query-def>unnamed protein product</BlastOutput_query-def>
<BlastOutput_query-len>15</BlastOutput_query-len>
<BlastOutput_query-len>31</BlastOutput_query-len>
<BlastOutput_param>
<Parameters>
<Parameters_matrix>BLOSUM62</Parameters_matrix>
<Parameters_expect>10</Parameters_expect>
<Parameters_gap-open>11</Parameters_gap-open>
<Parameters_gap-extend>1</Parameters_gap-extend>
<Parameters_gap-open>32767</Parameters_gap-open>
<Parameters_gap-extend>32767</Parameters_gap-extend>
<Parameters_filter>F</Parameters_filter>
</Parameters>
</BlastOutput_param>
<BlastOutput_iterations>
<Iteration>
<Iteration_iter-num>1</Iteration_iter-num>
<Iteration_query-ID>Query_36113</Iteration_query-ID>
<Iteration_query-ID>Query_20989</Iteration_query-ID>
<Iteration_query-def>unnamed protein product</Iteration_query-def>
<Iteration_query-len>15</Iteration_query-len>
<Iteration_query-len>31</Iteration_query-len>
<Iteration_hits>
<Hit>
<Hit_num>1</Hit_num>
Expand All @@ -33,63 +33,91 @@
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>32.7278</Hsp_bit-score>
<Hsp_score>73</Hsp_score>
<Hsp_evalue>0.00241999</Hsp_evalue>
<Hsp_bit-score>74.3789</Hsp_bit-score>
<Hsp_score>156</Hsp_score>
<Hsp_evalue>1.20691e-18</Hsp_evalue>
<Hsp_query-from>1</Hsp_query-from>
<Hsp_query-to>15</Hsp_query-to>
<Hsp_hit-from>140</Hsp_hit-from>
<Hsp_hit-to>154</Hsp_hit-to>
<Hsp_query-to>31</Hsp_query-to>
<Hsp_hit-from>132</Hsp_hit-from>
<Hsp_hit-to>162</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>14</Hsp_identity>
<Hsp_positive>14</Hsp_positive>
<Hsp_identity>30</Hsp_identity>
<Hsp_positive>30</Hsp_positive>
<Hsp_gaps>0</Hsp_gaps>
<Hsp_align-len>15</Hsp_align-len>
<Hsp_qseq>LGWEFLAFTRLTSEL</Hsp_qseq>
<Hsp_hseq>LGWEFLASTRLTSEL</Hsp_hseq>
<Hsp_midline>LGWEFLA TRLTSEL</Hsp_midline>
<Hsp_align-len>31</Hsp_align-len>
<Hsp_qseq>AAIMYVPALGWEFLAFTRLTSELNFLLQEID</Hsp_qseq>
<Hsp_hseq>AAIMYVPALGWEFLASTRLTSELNFLLQEID</Hsp_hseq>
<Hsp_midline>AAIMYVPALGWEFLA TRLTSELNFLLQEID</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>2</Hit_num>
<Hit_id>ref|NP_001153772.1|</Hit_id>
<Hit_def>pannexin-2 isoform 2 [Homo sapiens]</Hit_def>
<Hit_accession>NP_001153772</Hit_accession>
<Hit_len>643</Hit_len>
<Hit_id>ref|NP_056183.2|</Hit_id>
<Hit_def>pannexin-1 [Homo sapiens]</Hit_def>
<Hit_accession>NP_056183</Hit_accession>
<Hit_len>426</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>32.7278</Hsp_bit-score>
<Hsp_score>73</Hsp_score>
<Hsp_evalue>0.00242355</Hsp_evalue>
<Hsp_query-from>1</Hsp_query-from>
<Hsp_query-to>15</Hsp_query-to>
<Hsp_hit-from>140</Hsp_hit-from>
<Hsp_hit-to>154</Hsp_hit-to>
<Hsp_bit-score>29.4753</Hsp_bit-score>
<Hsp_score>58</Hsp_score>
<Hsp_evalue>0.0222996</Hsp_evalue>
<Hsp_query-from>7</Hsp_query-from>
<Hsp_query-to>31</Hsp_query-to>
<Hsp_hit-from>123</Hsp_hit-from>
<Hsp_hit-to>147</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>10</Hsp_identity>
<Hsp_positive>16</Hsp_positive>
<Hsp_gaps>0</Hsp_gaps>
<Hsp_align-len>25</Hsp_align-len>
<Hsp_qseq>PALGWEFLAFTRLTSELNFLLQEID</Hsp_qseq>
<Hsp_hseq>PPLFWRFAAAPHICSDLKFIMEELD</Hsp_hseq>
<Hsp_midline>P L W F A + S+L F+++E+D</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
<Hit>
<Hit_num>3</Hit_num>
<Hit_id>ref|NP_443191.1|</Hit_id>
<Hit_def>pannexin-3 [Homo sapiens]</Hit_def>
<Hit_accession>NP_443191</Hit_accession>
<Hit_len>392</Hit_len>
<Hit_hsps>
<Hsp>
<Hsp_num>1</Hsp_num>
<Hsp_bit-score>24.8933</Hsp_bit-score>
<Hsp_score>48</Hsp_score>
<Hsp_evalue>1.34491</Hsp_evalue>
<Hsp_query-from>9</Hsp_query-from>
<Hsp_query-to>31</Hsp_query-to>
<Hsp_hit-from>126</Hsp_hit-from>
<Hsp_hit-to>148</Hsp_hit-to>
<Hsp_query-frame>0</Hsp_query-frame>
<Hsp_hit-frame>0</Hsp_hit-frame>
<Hsp_identity>14</Hsp_identity>
<Hsp_positive>14</Hsp_positive>
<Hsp_identity>9</Hsp_identity>
<Hsp_positive>16</Hsp_positive>
<Hsp_gaps>0</Hsp_gaps>
<Hsp_align-len>15</Hsp_align-len>
<Hsp_qseq>LGWEFLAFTRLTSEL</Hsp_qseq>
<Hsp_hseq>LGWEFLASTRLTSEL</Hsp_hseq>
<Hsp_midline>LGWEFLA TRLTSEL</Hsp_midline>
<Hsp_align-len>23</Hsp_align-len>
<Hsp_qseq>LGWEFLAFTRLTSELNFLLQEID</Hsp_qseq>
<Hsp_hseq>LLWQYAAVPALSSDLLFIISELD</Hsp_hseq>
<Hsp_midline>L W++ A L+S+L F++ E+D</Hsp_midline>
</Hsp>
</Hit_hsps>
</Hit>
</Iteration_hits>
<Iteration_stat>
<Statistics>
<Statistics_db-num>83047</Statistics_db-num>
<Statistics_db-len>57128675</Statistics_db-len>
<Statistics_db-num>19373</Statistics_db-num>
<Statistics_db-len>11232665</Statistics_db-len>
<Statistics_hsp-len>0</Statistics_hsp-len>
<Statistics_eff-space>0</Statistics_eff-space>
<Statistics_kappa>0.041</Statistics_kappa>
<Statistics_lambda>0.267</Statistics_lambda>
<Statistics_entropy>0.14</Statistics_entropy>
<Statistics_kappa>0.134</Statistics_kappa>
<Statistics_lambda>0.3176</Statistics_lambda>
<Statistics_entropy>0.4012</Statistics_entropy>
</Statistics>
</Iteration_stat>
</Iteration>
Expand Down

0 comments on commit 520bc33

Please sign in to comment.